Structure of PDB 6rbe Chain B

Receptor sequence
>6rbeB (length=113) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TDKLRSMVRKWQTLIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYA
QSSHIRAIRKVISEILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFP
LQNIHVRKVKLLK
3D structure
PDB6rbe Conformational proofreading of distant 40S ribosomal subunit maturation events by a long-range communication mechanism.
ChainB
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B K116 W117 Q118 L120 R136 Q146 N148 Q149 V150 K151 H153 Y155 Q157 S158 R162 R165 K166 K202 D203 I204 F205 K10 W11 Q12 L14 R30 Q40 N42 Q43 V44 K45 H47 Y49 Q51 S52 R56 R59 K60 K96 D97 I98 F99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rbe, PDBe:6rbe, PDBj:6rbe
PDBsum6rbe
PubMed31227701
UniProtP33442|RS3A1_YEAST Small ribosomal subunit protein eS1A (Gene Name=RPS1A)

[Back to BioLiP]