Structure of PDB 6r2v Chain B

Receptor sequence
>6r2vB (length=93) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SPREQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGE
ASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFRE
3D structure
PDB6r2v Structural determinants for NF-Y subunit organization and NF-Y/DNA association in plants.
ChainB
Resolution2.503 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B Q28 K42 K50 I51 S52 K53 K84 Q5 K19 K27 I28 S29 K30 K61
BS02 dna B P33 I34 A35 N36 R39 K50 P10 I11 A12 N13 R16 K27
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6r2v, PDBe:6r2v, PDBj:6r2v
PDBsum6r2v
PubMed33098724
UniProtQ9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 (Gene Name=NFYB2)

[Back to BioLiP]