Structure of PDB 6qyb Chain B

Receptor sequence

>6qybB (length=120) Species: 1200984 (Streptomyces lividans 1326) [Search protein sequence]

GGVDREAMARCIEECLRCAQACTACADACLSEPTVADLTKCIRTDMDCAD
VCTATAAVLSRHTGYDANVTRAVLQACATVCAACGDECARHAGMAEHCRV
CAEACRSCEQACQELLAGLG

3D structure

PDB

6qyb A Histidine Residue and a Tetranuclear Cuprous-thiolate Cluster Dominate the Copper Loading Landscape of a Copper Storage Protein from Streptomyces lividans.

Chain

Resolution

1.18 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CU1	B	C38 D61 C100	C22 D45 C84
BS02	CU1	B	C64 C121	C48 C105
BS03	CU1	B	C34 C38	C18 C22
BS04	CU1	B	C41 C45	C25 C29
BS05	CU1	B	H113 C114	H97 C98
BS06	CU1	B	C117 C121	C101 C105
BS07	CU1	B	D61 C104 C117	D45 C88 C101
BS08	CU1	B	C41 C104 C114	C25 C88 C98
BS09	CU1	B	C68 C124	C52 C108
BS10	CU1	B	C27 C31	C11 C15
BS11	CU1	B	C27 C128	C11 C112
BS12	CU1	B	C124 C128	C108 C112
BS13	CU1	B	C93 C97	C77 C81
BS14	CU1	B	C31 C93	C15 C77
BS15	CU1	B	C34 C97	C18 C81
BS16	CU1	B	C64 C68	C48 C52
BS17	CU1	B	C45 C57	C29 C41
BS18	CU1	B	C100 C104	C84 C88
BS19	CU1	B	C57 D61	C41 D45

External links

PDB	RCSB:6qyb, PDBe:6qyb, PDBj:6qyb
PDBsum	6qyb
PubMed	31111982
UniProt	Q9X8F4

[Back to BioLiP]