Structure of PDB 6qq7 Chain B

Receptor sequence
>6qq7B (length=30) Species: 9913 (Bos taurus) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
3D structure
PDB6qq7 Insulin conformational changes under high pressure in structural studies and molecular dynamics simulations
ChainB
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B V2 N3 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25 P28 V2 N3 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25 P28
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6qq7, PDBe:6qq7, PDBj:6qq7
PDBsum6qq7
PubMed
UniProtP01317|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]