Structure of PDB 6qnx Chain B

Receptor sequence
>6qnxB (length=74) Species: 9606 (Homo sapiens) [Search protein sequence]
KRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVE
KLFSLPAQPLWNNRLLKLFTRCLT
3D structure
PDB6qnx The structural basis for cohesin-CTCF-anchored loops.
ChainB
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B S334 I337 R338 S14 I17 R18
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0106222 lncRNA binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0001666 response to hypoxia
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006915 apoptotic process
GO:0007059 chromosome segregation
GO:0007062 sister chromatid cohesion
GO:0007131 reciprocal meiotic recombination
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0010972 negative regulation of G2/M transition of mitotic cell cycle
GO:0032691 negative regulation of interleukin-1 beta production
GO:0032720 negative regulation of tumor necrosis factor production
GO:0032733 positive regulation of interleukin-10 production
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0034089 establishment of meiotic sister chromatid cohesion
GO:0034351 negative regulation of glial cell apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045841 negative regulation of mitotic metaphase/anaphase transition
GO:0045876 positive regulation of sister chromatid cohesion
GO:0051301 cell division
GO:0071168 protein localization to chromatin
GO:0140588 chromatin looping
GO:1990414 replication-born double-strand break repair via sister chromatid exchange
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000785 chromatin
GO:0000794 condensed nuclear chromosome
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0008278 cohesin complex
GO:0016020 membrane
GO:0016363 nuclear matrix
GO:0030496 midbody
GO:0030892 mitotic cohesin complex
GO:0030893 meiotic cohesin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qnx, PDBe:6qnx, PDBj:6qnx
PDBsum6qnx
PubMed31905366
UniProtO60216|RAD21_HUMAN Double-strand-break repair protein rad21 homolog (Gene Name=RAD21)

[Back to BioLiP]