Structure of PDB 6qkn Chain B

Receptor sequence

>6qknB (length=323) Species: 485 (Neisseria gonorrhoeae)

EDQDLLKRAQGVFQPLPTVEEMQKIRPFTEEQVKLGHQLWYEPRLSKGNT
VSCNSCHNLASAGVDNMPTSQGHKGQFGGRNSPTALNAALLGSQFWDGRA
ADVEEQAGGPLVNPVEMANDSQEAAAAKIAKVPEYQEMFKKAFPEDGAVS
FKNITTALGAFERTLLTPTKWDEYLKGNVNALSEQERKGVRAFMDNGCIA
CHNGVNLGGTTFQKFGLVQGPYWKFIEDPKRDKGRADVTKKTEDEFFFRV
PGLRNVAKTYPYFHNGSVWELDKAVTIMGKAQLGKDIPKEDVDNIVVFLN
ALSGNVSESARTMPELPLTAPME

3D structure

• PDB: 6qkn Structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium Neisseria gonorrhoeae
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	B	C55 C58 H59 Q73 G74 R82 N83 S84 P85 Q96 F97 W98 R101 Q108 P112 M119 E164 R251	C53 C56 H57 Q71 G72 R80 N81 S82 P83 Q94 F95 W96 R99 Q106 P110 M117 E162 R249
BS02	HEC	B	W98 C200 C203 H204 Q215 F217 F250 P253 Y264 F265 H266 M280 Q284 L285	W96 C198 C201 H202 Q213 F215 F248 P251 Y262 F263 H264 M278 Q282 L283
BS03	CA	B	N83 T261 P263	N81 T259 P261
BS04	AZI	B	F97 Q108 P112 E118	F95 Q106 P110 E116

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:6qkn, PDBe:6qkn, PDBj:6qkn
• PDBsum: 6qkn
• UniProt: Q5F5Z9