Structure of PDB 6q9s Chain B

Receptor sequence
>6q9sB (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
NQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMV
YCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLA
3D structure
PDB6q9s Structural States of Hdm2 and HdmX: X-ray Elucidation of Adaptations and Binding Interactions for Different Chemical Compound Classes.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 O4B B V93 Y100 V68 Y75
BS02 O4B B K31 K105 K6 K80
BS03 O4B B G78 E84 G87 R88 Q89 G53 E59 G62 R63 Q64
BS04 O4B B L85 L86 L60 L61
BS05 HRN B M54 H55 I61 M62 Y67 Q72 F91 V93 P96 L99 M29 H30 I36 M37 Y42 Q47 F66 V68 P71 L74 MOAD: ic50=17nM
BS06 O4B B K36 L81 K11 L56
BS07 O4B B H55 G58 Q59 M62 H30 G33 Q34 M37
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q9s, PDBe:6q9s, PDBj:6q9s
PDBsum6q9s
PubMed31066983
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]