Structure of PDB 6q6b Chain B

Receptor sequence
>6q6bB (length=118) Species: 1200984 (Streptomyces lividans 1326) [Search protein sequence]
VDREAMARCIEECLRCAQACTACADACLSEPTVADLTKCIRTDMDCADVC
TATAAVLSRHTGYDANVTRAVLQACATVCAACGDECARHAGMHEHCRVCA
EACRSCEQACQELLAGLG
3D structure
PDB6q6b A Histidine Residue and a Tetranuclear Cuprous-thiolate Cluster Dominate the Copper Loading Landscape of a Copper Storage Protein from Streptomyces lividans.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU1 B C41 H113 C114 C23 H95 C96
BS02 CU1 B C57 C114 C39 C96
BS03 CU1 B C57 C104 C39 C86
BS04 CU1 B C38 C64 C100 C20 C46 C82
BS05 CU1 B C124 C128 C106 C110
BS06 CU1 B C64 C68 C46 C50
BS07 CU1 B C93 C97 C75 C79
BS08 CU1 B C64 C121 C46 C103
BS09 CU1 B C93 C128 C75 C110
BS10 CU B C68 C124 C50 C106
BS11 CU B C34 C97 C124 C16 C79 C106
BS12 CU B C41 D61 C104 C117 C23 D43 C86 C99
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6q6b, PDBe:6q6b, PDBj:6q6b
PDBsum6q6b
PubMed31111982
UniProtQ9X8F4

[Back to BioLiP]