Structure of PDB 6q2q Chain B

Receptor sequence

>6q2qB (length=290) Species: 10090 (Mus musculus)

RTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGLE
KINFSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGSLIRERWFKD
YGEYLDILAISCDSFDEQVNALIGRGQNHVENLQKLRRWCRDYKVAFKIN
SVINRFNVDEDMNEHIKALSPVRWKVFQCLLIEGENSGADALRAAERFLI
SNEEFETFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCTGGRKDPS
KSILDVGVEEAIKFSGFDEKMFLKRGGKYVWSKADLKLDW

3D structure

• PDB: 6q2q Structural Basis of the Substrate Selectivity of Viperin.
• Chain: B
• Resolution: 1.892 Å

Enzymatic activity

• Enzyme Commision number: 4.2.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C84 Y86 C88 C91 G126 N158 R194	C15 Y17 C19 C22 G57 N89 R125
BS02	SAH	B	F90 F92 S124 G125 G126 V156 S157 S180 R194 N222 V224 L252 M298	F21 F23 S55 G56 G57 V87 S88 S111 R125 N150 V152 L180 M226
BS03	UTP	B	N77 H79 F92 K120 N122 S124 K220 N222 R245 K247 F249 Y302 I304 K319 Y351	N8 H10 F23 K51 N53 S55 K148 N150 R173 K175 F177 Y230 I232 K247 Y279

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0051536 iron-sulfur cluster binding

Biological Process

• GO:0051607 defense response to virus

Cellular Component

• GO:0005789 endoplasmic reticulum membrane
• GO:0005811 lipid droplet

External links

• PDB: RCSB:6q2q, PDBe:6q2q, PDBj:6q2q
• PDBsum: 6q2q
• PubMed: 31917549
• UniProt: Q8CBB9|RSAD2_MOUSE S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 (Gene Name=Rsad2)