Structure of PDB 6pwf Chain B

Receptor sequence
>6pwfB (length=88) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN
VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB6pwf Structure of the primed state of the ATPase domain of chromatin remodeling factor ISWI bound to the nucleosome.
ChainB
Resolution4.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B P32 R36 R45 P18 R22 R31
BS02 dna B R35 R45 I46 S47 G48 K79 T80 R21 R31 I32 S33 G34 K65 T66
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000228 nuclear chromosome
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pwf, PDBe:6pwf, PDBj:6pwf
PDBsum6pwf
PubMed31402386
UniProtP84040|H4_DROME Histone H4 (Gene Name=His4)

[Back to BioLiP]