Structure of PDB 6pml Chain B |
>6pmlB (length=188) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKL PEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQ TIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGV PAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK |
|
PDB | 6pml The Fragment-Based Development of a Benzofuran Hit as a New Class of Escherichia coli DsbA Inhibitors. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
OR4 |
B |
F29 G65 |
F29 G65 |
|
BS02 |
CU |
B |
A1 E4 |
A1 E4 |
|
|
|
|