Structure of PDB 6ple Chain B

Receptor sequence
>6pleB (length=96) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
PVVKINAIEVPAGAGPELEKRFAHSAHAVENSPGFLGFQLLRPVKGEERY
FVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLD
3D structure
PDB6ple Structure of aMycobacterium tuberculosisHeme-Degrading Protein, MhuD, Variant in Complex with Its Product.
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.14.99.57: heme oxygenase (mycobilin-producing).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BLA B A67 R79 A84 S88 L89 A66 R78 A83 S87 L88
BS02 BLA B N7 I9 R22 F23 T55 W66 H75 H78 P82 V83 A84 N6 I8 R21 F22 T54 W65 H74 H77 P81 V82 A83
Gene Ontology
Molecular Function
GO:0004392 heme oxygenase (decyclizing) activity
GO:0004497 monooxygenase activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0042167 heme catabolic process
Cellular Component
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ple, PDBe:6ple, PDBj:6ple
PDBsum6ple
PubMed31638374
UniProtP9WKH3|MHUD_MYCTU Heme oxygenase (mycobilin-producing) (Gene Name=mhuD)

[Back to BioLiP]