Structure of PDB 6p8e Chain B

Receptor sequence

>6p8eB (length=260) Species: 9606 (Homo sapiens) [Search protein sequence]

GTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPN
VVRLMDVCATSEIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQF
LRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLTLWYRAPEVLLQS
TYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWP
RDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRA
LQHSYLHKDE

3D structure

PDB

6p8e p27 allosterically activates cyclin-dependent kinase 4 and antagonizes palbociclib inhibition.

Chain

Resolution

2.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D137 K139 E141 N142 D155 T174
Catalytic site (residue number reindexed from 1)	D116 K118 E120 N121 D134 T138
Enzyme Commision number	2.7.11.22: cyclin-dependent kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	H135 N142 A154 D155	H114 N121 A133 D134
BS02	MG	B	G42 E44 G45	G25 E27 G28

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004693	cyclin-dependent protein serine/threonine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016301	kinase activity
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0030332	cyclin binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0000082	G1/S transition of mitotic cell cycle
GO:0006468	protein phosphorylation
GO:0007165	signal transduction
GO:0008284	positive regulation of cell population proliferation
GO:0009410	response to xenobiotic stimulus
GO:0010389	regulation of G2/M transition of mitotic cell cycle
GO:0010468	regulation of gene expression
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle
GO:0016310	phosphorylation
GO:0048146	positive regulation of fibroblast proliferation
GO:0051301	cell division
GO:0051726	regulation of cell cycle
GO:0060260	regulation of transcription initiation by RNA polymerase II
GO:0061469	regulation of type B pancreatic cell proliferation
GO:0071222	cellular response to lipopolysaccharide
GO:0071353	cellular response to interleukin-4
GO:1904628	cellular response to phorbol 13-acetate 12-myristate
GO:1904637	cellular response to ionomycin

	Cellular Component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005667	transcription regulator complex
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005923	bicellular tight junction
GO:0016020	membrane
GO:0031965	nuclear membrane
GO:0097128	cyclin D1-CDK4 complex
GO:0097129	cyclin D2-CDK4 complex
GO:0097130	cyclin D3-CDK4 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6p8e, PDBe:6p8e, PDBj:6p8e
PDBsum	6p8e
PubMed	31831640
UniProt	P11802\|CDK4_HUMAN Cyclin-dependent kinase 4 (Gene Name=CDK4)

[Back to BioLiP]