Structure of PDB 6p2i Chain B

Receptor sequence
>6p2iB (length=307) Species: 1761756 (Bacillus sp. 5mfcol3.1) [Search protein sequence]
MKITYIDKPTYLPSWVINKINEYGDFEVFYDFPNEEEAINRLSSTDIAIV
EWTSITKEMIEKISRLKYLITITTSYDYIDVNSLKDNEIMVSNCPQYSKQ
AVAEHVFALLFAVNRKILQADETCRKGLSHIYPPFLCSEIRDKTIGLIGI
GQIGQTVAEIANAFQMKVIGLNKSKRNVKGIQQVDITELMKKSDIISLHI
PRNADTEIILTEKLLSLMKPDAVLINTCRGNLIDEQALYSVLKQNRIRGA
GLDDLTYYKDNPIIGLNNVVLTPGSAWYSYEAREKNMYELIENIESYLAQ
KPVNVIL
3D structure
PDB6p2i An Asymmetric Reductase That Intercepts Acyclic Imino Acids Producedin Situby a Partner Oxidase.
ChainB
Resolution1.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP B S98 V102 G149 I150 G151 Q152 I153 N172 K173 S174 H199 I200 P201 T206 T227 C228 W277 S98 V102 G149 I150 G151 Q152 I153 N172 K173 S174 H199 I200 P201 T206 T227 C228 W277
BS02 DAR B E51 T73 T74 S75 Y97 W277 E51 T73 T74 S75 Y97 W277
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 01:54:37 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6p2i', asym_id = 'B', title = 'An Asymmetric Reductase That Intercepts Acyclic Imino Acids Producedin Situby a Partner Oxidase.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6p2i', asym_id='B', title='An Asymmetric Reductase That Intercepts Acyclic Imino Acids Producedin Situby a Partner Oxidase.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016616,0051287', uniprot = '', pdbid = '6p2i', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016616,0051287', uniprot='', pdbid='6p2i', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>