Structure of PDB 6ozq Chain B

Receptor sequence

>6ozqB (length=246) Species: 10090 (Mus musculus)

RPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVK
GDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVEL
VQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAMKL
LQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPL
YVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTLGQ

3D structure

• PDB: 6ozq Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
• Chain: B
• Resolution: 2.153 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	S203 T204 K205 F230 R231 R237 R244 R248	S196 T197 K198 F223 R224 R230 R237 R241
BS02	rna	B	V53 S54 F55 K57 Y91 S93 G94 L96 D126 N128 H132 Q133 G137 V138 A154 M155 K156 L158 Q159	V46 S47 F48 K50 Y84 S86 G87 L89 D119 N121 H125 Q126 G130 V131 A147 M148 K149 L151 Q152
BS03	MN	B	D52 D126 D240	D45 D119 D233

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:6ozq, PDBe:6ozq, PDBj:6ozq
• PDBsum: 6ozq
• PubMed: 31444105
• UniProt: Q8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)