Structure of PDB 6ozk Chain B

Receptor sequence

>6ozkB (length=246) Species: 10090 (Mus musculus)

AERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSF
VKGDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLV
ELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAK
KLLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTK
PLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTA

3D structure

• PDB: 6ozk Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
• Chain: B
• Resolution: 2.104 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	H202 S203 K205 F230 R231 R237 R244 R248	H197 S198 K200 F225 R226 R232 R239 R243
BS02	rna	B	S54 F55 K57 Y91 S93 G94 L96 D126 N128 H132 G137 V138 K155 K156 L157	S49 F50 K52 Y86 S88 G89 L91 D121 N123 H127 G132 V133 K150 K151 L152
BS03	CA	B	D52 D240	D47 D235
BS04	CA	B	D52 V53 D126	D47 V48 D121

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:6ozk, PDBe:6ozk, PDBj:6ozk
• PDBsum: 6ozk
• PubMed: 31444105
• UniProt: Q8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)