Structure of PDB 6ora Chain B

Receptor sequence

>6oraB (length=298) Species: 70601 (Pyrococcus horikoshii OT3)

DLVEEILRLKEERNAIILAHNYQLPEVQDIADFIGDSLELARRATRVDAD
VIVFAGVDFMAETAKILNPDKVVLIPSREATCAMANMLKVEHILEAKRKY
PNAPVVLYVNSTAEAKAYADVTVTSANAVEVVKKLDSDVVIFGPDKNLAH
YVAKMTGKKIIPVPSKGHCYVHQKFTLDDVERAKKLHPNAKLMIHPQCIP
EVQEKADIIASTGGMIKRACEWDEWVVFTEREMVYRLRKLYPQKKFYPAR
EDAFCIGMKAITLKNIYESLKDMKYKVEVPEEIARKARKAIERMLEMS

3D structure

• PDB: 6ora An Unexpected Species Determined by X-ray Crystallography that May Represent an Intermediate in the Reaction Catalyzed by Quinolinate Synthase.
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.72: quinolinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	Y23 C83 C170 V172 C256	Y22 C82 C169 V171 C255
BS02	5XR	B	H21 Y23 D37 S38 L39 Y109 T125 S126 H196 S212 T213	H20 Y22 D36 S37 L38 Y108 T124 S125 H195 S211 T212
BS03	CL	B	R44 V48	R43 V47

Gene Ontology

Molecular Function

• GO:0008987 quinolinate synthetase A activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009435 NAD biosynthetic process
• GO:0019363 pyridine nucleotide biosynthetic process
• GO:0019805 quinolinate biosynthetic process
• GO:0034628 'de novo' NAD biosynthetic process from aspartate

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6ora, PDBe:6ora, PDBj:6ora
• PDBsum: 6ora
• PubMed: 31390192
• UniProt: O57767|NADA_PYRHO Quinolinate synthase (Gene Name=nadA)