Structure of PDB 6oqq Chain B

Receptor sequence
>6oqqB (length=133) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLM
NEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISA
AELKHVLTSIGEKLTDAEVDDMINIQQFAALLS
3D structure
PDB6oqq Bacterial pseudokinase catalyzes protein polyglutamylation to inhibit the SidE-family ubiquitin ligases.
ChainB
Resolution2.102 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B D21 D23 N25 S27 D18 D20 N22 S24
BS02 CA B D94 N96 D98 L100 D91 N93 D95 L97
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0030234 enzyme regulator activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051019 mitogen-activated protein kinase binding
Biological Process
GO:0000742 karyogamy involved in conjugation with cellular fusion
GO:0006606 protein import into nucleus
GO:0006661 phosphatidylinositol biosynthetic process
GO:0006897 endocytosis
GO:0006898 receptor-mediated endocytosis
GO:0007010 cytoskeleton organization
GO:0007114 cell budding
GO:0010968 regulation of microtubule nucleation
GO:0016237 microautophagy
GO:0030050 vesicle transport along actin filament
GO:0042144 vacuole fusion, non-autophagic
GO:0051300 spindle pole body organization
GO:0071474 cellular hyperosmotic response
GO:1903525 regulation of membrane tubulation
GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation
Cellular Component
GO:0000131 incipient cellular bud site
GO:0005737 cytoplasm
GO:0005816 spindle pole body
GO:0005823 central plaque of spindle pole body
GO:0005856 cytoskeleton
GO:0005933 cellular bud
GO:0005934 cellular bud tip
GO:0005935 cellular bud neck
GO:0030479 actin cortical patch
GO:0031475 myosin V complex
GO:0043332 mating projection tip
GO:0045160 myosin I complex
GO:0051286 cell tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oqq, PDBe:6oqq, PDBj:6oqq
PDBsum6oqq
PubMed31123136
UniProtP06787|CALM_YEAST Calmodulin (Gene Name=CMD1)

[Back to BioLiP]