Structure of PDB 6opv Chain B

Receptor sequence

>6opvB (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPLVTVKIEGQLKEALLDTGADDTIFEEMNLPGRWKPIIIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPFNVIGRNLLTQIGCTLNF

3D structure

• PDB: 6opv Picomolar to Micromolar: Elucidating the Role of Distal Mutations in HIV-1 Protease in Conferring Drug Resistance.
• Chain: B
• Resolution: 1.91 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	017	B	D25 G27 A28 D30 G49 P81	D25 G27 A28 D30 G49 P81	MOAD: Ki=12.8nM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:6opv, PDBe:6opv, PDBj:6opv
• PDBsum: 6opv
• PubMed: 31361460
• UniProt: Q7ZCI0