Structure of PDB 6ono Chain B |
>6onoB (length=69) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
TLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERI RQIESKTMSKLRHPSRSQV |
|
PDB | 6ono Structural basis of non-canonical transcriptional regulation by the sigma A-bound iron-sulfur protein WhiB1 in M. tuberculosis. |
Chain | B |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SF4 |
B |
H516 P517 |
H63 P64 |
|
|
|
|