Structure of PDB 6om4 Chain B

Receptor sequence

>6om4B (length=344) Species: 562 (Escherichia coli)

MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSS
YTAALETANIPEKDFSNCFRFLKENFFIIPSEYNNNNRYSRNFLHYQSYG
ANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENT
NLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKV
PEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPG
KTGCYECQKVVADLYGAEKENIDHKIKLINSRFKPATFAPVNNVAAALCA
ADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG

3D structure

• PDB: 6om4 Biosynthesis of the RiPP trojan horse nucleotide antibiotic microcin C is directed by theN-formyl of the peptide precursor.
• Chain: B
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	K10 Y14 G23 E26	K10 Y14 G23 E26
BS02	peptide	B	I126 S212 A213 D214 N236 A237 G238 Y239 V240 V245 V264 A265 Y268 R322 G324 W326 Q335	I123 S209 A210 D211 N233 A234 G235 Y236 V237 V242 V261 A262 Y265 R319 G321 W323 Q332
BS03	ZN	B	C257 C260 C343 C346	C254 C257 C340 C343
BS04	MG	B	D148 E151	D145 E148
BS05	POP	B	N154 R157 Q158 K170	N151 R154 Q155 K167
BS06	ND7	B	G124 D146 N147 K170 I194 S212 A213 D214 H215	G121 D143 N144 K167 I191 S209 A210 D211 H212

Gene Ontology

Molecular Function

• GO:0004792 thiosulfate sulfurtransferase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008641 ubiquitin-like modifier activating enzyme activity
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6om4, PDBe:6om4, PDBj:6om4
• PDBsum: 6om4
• PubMed: 30881667
• UniProt: Q47506