Structure of PDB 6oii Chain B

Receptor sequence

>6oiiB (length=122) Species: 7159 (Aedes aegypti)

EFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVF
NKMQLFDDTEGPLVDNLVHQLAHGRDAEEVRTEVLKCVDKNTDNNACHWA
FRGFKCFQKNNLSLIKASIKKD

3D structure

• PDB: 6oii Aedes aegypti Odorant Binding Protein 22 selectively binds fatty acids through a conformational change in its C-terminal tail.
• Chain: B
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ACD	B	R15 W35 Y46 F51 M54 L56 P63 L68 C88 G104 I116 I120	R14 W34 Y45 F50 M53 L55 P62 L67 C87 G103 I115 I119
BS02	CO	B	H74 D123	H73 D122

Gene Ontology

Molecular Function

• GO:0005549 odorant binding
• GO:0008289 lipid binding

Biological Process

• GO:0007608 sensory perception of smell

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:6oii, PDBe:6oii, PDBj:6oii
• PDBsum: 6oii
• PubMed: 32094450
• UniProt: Q1HRL7