Structure of PDB 6oie Chain B

Receptor sequence

>6oieB (length=111) Species: 9606 (Homo sapiens)

MDPIPICSFCLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNV
KALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPK
GMWICQVCRPK

3D structure

• PDB: 6oie Histone H3K23-specific acetylation by MORF is coupled to H3K14 acylation.
• Chain: B
• Resolution: 2.075 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	S217 F218 L220 S242 S243 K250 I267 E268 L286 F287 D289 D292 M307 P308 G310	S8 F9 L11 S33 S34 K41 I58 E59 L77 F78 D80 D83 M98 P99 G101
BS02	ZN	B	C288 C291 C314 C317	C79 C82 C105 C108
BS03	ZN	B	C272 C275 H296 C299	C63 C66 H87 C90
BS04	ZN	B	C216 C219 H245 C248	C7 C10 H36 C39
BS05	ZN	B	C237 C240 C266 C269	C28 C31 C57 C60

External links

• PDB: RCSB:6oie, PDBe:6oie, PDBj:6oie
• PDBsum: 6oie
• PubMed: 31624313
• UniProt: Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B (Gene Name=KAT6B)