Structure of PDB 6nuc Chain B

Receptor sequence
>6nucB (length=156) Species: 9606 (Homo sapiens) [Search protein sequence]
MDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDT
DGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQ
VLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHK
KMVVDV
3D structure
PDB6nuc Molecular basis for the binding and selective dephosphorylation of Na+/H+exchanger 1 by calcineurin.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B Q51 P53 M119 V120 N123 Q37 P39 M105 V106 N109
BS02 CA B D63 D65 N67 E69 E74 D49 D51 N53 E55 E60
BS03 CA B D141 D143 D145 R147 E152 D127 D129 D131 R133 E138
BS04 CA B D31 D33 S35 S37 E42 D17 D19 S21 S23 E28
BS05 CA B D100 D102 D104 Y106 E111 D86 D88 D90 Y92 E97
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004723 calcium-dependent protein serine/threonine phosphatase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005516 calmodulin binding
GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity
GO:0019902 phosphatase binding
GO:0019904 protein domain specific binding
GO:0046872 metal ion binding
Biological Process
GO:0001569 branching involved in blood vessel morphogenesis
GO:0001837 epithelial to mesenchymal transition
GO:0006606 protein import into nucleus
GO:0007507 heart development
GO:0014044 Schwann cell development
GO:0022011 myelination in peripheral nervous system
GO:0033173 calcineurin-NFAT signaling cascade
GO:0034504 protein localization to nucleus
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060487 lung epithelial cell differentiation
GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
GO:0097720 calcineurin-mediated signaling
GO:0098693 regulation of synaptic vesicle cycle
GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
GO:0099170 postsynaptic modulation of chemical synaptic transmission
GO:1905665 positive regulation of calcium ion import across plasma membrane
GO:1905949 negative regulation of calcium ion import across plasma membrane
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005955 calcineurin complex
GO:0008287 protein serine/threonine phosphatase complex
GO:0042383 sarcolemma
GO:0045202 synapse
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0098688 parallel fiber to Purkinje cell synapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nuc, PDBe:6nuc, PDBj:6nuc
PDBsum6nuc
PubMed31375679
UniProtP63098|CANB1_HUMAN Calcineurin subunit B type 1 (Gene Name=PPP3R1)

[Back to BioLiP]