Structure of PDB 6npi Chain B

Receptor sequence
>6npiB (length=134) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence]
SNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRG
TALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAE
VLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
3D structure
PDB6npi Structure-based design of small-molecule inhibitors of EBNA1 DNA binding blocks Epstein-Barr virus latent infection and tumor growth.
ChainB
Resolution1.501 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.21.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 60Q B K477 I481 S516 N519 T590 K4 I8 S43 N46 T117
BS02 KW1 B K514 R521 P535 L536 K41 R48 P62 L63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6npi, PDBe:6npi, PDBj:6npi
PDBsum6npi
PubMed30842315
UniProtP03211|EBNA1_EBVB9 Epstein-Barr nuclear antigen 1 (Gene Name=EBNA1)

[Back to BioLiP]