Structure of PDB 6n7p Chain B

Receptor sequence

>6n7pB (length=195) Species: 559292 (Saccharomyces cerevisiae S288C)

RYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHK
RRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSI
DTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQT
SRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVD

3D structure

• PDB: 6n7p A unified mechanism for intron and exon definition and back-splicing.
• Chain: B
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	H15 V20 D36 R39 N40 R43 D44 H51 K52 R53 R54 H55 G57 K58 R59 G60 K62 E63 R64 K74 V75 C77 L78 N80 K83 R84 M87	H13 V18 D34 R37 N38 R41 D42 H49 K50 R51 R52 H53 G55 K56 R57 G58 K60 E61 R62 K72 V73 C75 L76 N78 K81 R82 M85
BS02	rna	B	T14 H24 K28 R139 A140 E142	T12 H22 K26 R137 A138 E140
BS03	ZN	B	C6 C9 H24 H30	C4 C7 H22 H28

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0008270 zinc ion binding
• GO:0030619 U1 snRNA binding
• GO:0030627 pre-mRNA 5'-splice site binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000387 spliceosomal snRNP assembly
• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0071004 U2-type prespliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n7p, PDBe:6n7p, PDBj:6n7p
• PDBsum: 6n7p
• PubMed: 31485080
• UniProt: Q05900|RU1C_YEAST U1 small nuclear ribonucleoprotein C (Gene Name=YHC1)