Structure of PDB 6n2m Chain B |
>6n2mB (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLS DPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPA RVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSKDD |
|
PDB | 6n2m Structures of autoinhibited and polymerized forms of CARD9 reveal mechanisms of CARD9 and CARD11 activation. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
D3 C10 H73 |
D3 C10 H73 |
|
|
|
|