Structure of PDB 6n1o Chain B

Receptor sequence

>6n1oB (length=104) Species: 10116 (Rattus norvegicus) [Search protein sequence]

GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFEYTD
ANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK
ATNE

3D structure

PDB

6n1o Serine-47 phosphorylation of cytochromecin the mammalian brain regulates cytochromecoxidase and caspase-3 activity.

Chain

Resolution

1.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	B	K13 C14 C17 H18 T28 G29 P30 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82	K13 C14 C17 H18 T28 G29 P30 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82
BS02	FC6	B	K87 G89	K87 G89
BS03	FC6	B	K86 K87	K86 K87

Gene Ontology

	Biological Process
GO:0002931	response to ischemia
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
GO:0006915	apoptotic process
GO:0006979	response to oxidative stress
GO:0009629	response to gravity
GO:0010730	negative regulation of hydrogen peroxide biosynthetic process
GO:0034349	glial cell apoptotic process
GO:0034465	response to carbon monoxide
GO:0042743	hydrogen peroxide metabolic process
GO:0046688	response to copper ion
GO:1901857	positive regulation of cellular respiration

	Cellular Component
GO:0005739	mitochondrion
GO:0005758	mitochondrial intermembrane space
GO:0005829	cytosol
GO:0043293	apoptosome

External links

PDB	RCSB:6n1o, PDBe:6n1o, PDBj:6n1o
PDBsum	6n1o
PubMed	31570002
UniProt	P62898\|CYC_RAT Cytochrome c, somatic (Gene Name=Cycs)