Structure of PDB 6mqf Chain B

Receptor sequence

>6mqfB (length=122) Species: 98334 (Bothrops moojeni)

SLFELGKMILQETGKNPAKSYGVYGCNCGVGGRGKPKDATDRCCYVHKCC
YKKLTGCDPKKDRYSYSWKDKTIVCGENNSCLKELCECDKAVAICLRENL
DTYNKKYRYNYLKPFCKKADPC

3D structure

• PDB: 6mqf Search for efficient inhibitors of myotoxic activity induced by ophidian phospholipase A2-like proteins using functional, structural and bioinformatics approaches.
• Chain: B
• Resolution: 1.693 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N28 G30 G32 H48 K49 Y52 Y73 D99
• Catalytic site (residue number reindexed from 1): N27 G29 G31 H47 K48 Y51 Y64 D89

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AIN	B	L2 G30 V31 K49 K69	L2 G29 V30 K48 K60

Gene Ontology

Molecular Function

• GO:0004623 phospholipase A2 activity
• GO:0005509 calcium ion binding
• GO:0005543 phospholipid binding
• GO:0047498 calcium-dependent phospholipase A2 activity
• GO:0090729 toxin activity

Biological Process

• GO:0006644 phospholipid metabolic process
• GO:0016042 lipid catabolic process
• GO:0031640 killing of cells of another organism
• GO:0035821 modulation of process of another organism
• GO:0042130 negative regulation of T cell proliferation
• GO:0042742 defense response to bacterium
• GO:0050482 arachidonate secretion
• GO:0050832 defense response to fungus

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:6mqf, PDBe:6mqf, PDBj:6mqf
• PDBsum: 6mqf
• PubMed: 30679550
• UniProt: Q9I834|PA2H2_BOTMO Basic phospholipase A2 homolog myotoxin II