Structure of PDB 6mkl Chain B |
>6mklB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPIVTIKVGGQLREALIDTGADDTIFEEINLPGRWKPKLIGGI GGFMKVRQYDQIPIEICGHQAIGTVLVGPTPINVIGRNMLTQIGCTLNF |
|
PDB | 6mkl In vitro selection of highly darunavir-resistant and replication-competent HIV-1 variants by using a mixture of clinical HIV-1 isolates resistant to multiple conventional protease inhibitors. |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|