Structure of PDB 6lvu Chain B

Receptor sequence

>6lvuB (length=78) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence]

SREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFES
EFGVKVDDADLEKISTVGDIVSYIEKKL

3D structure

PDB

6lvu Structural Characterization of an ACP fromThermotoga maritima: Insights into Hyperthermal Adaptation.

Chain

Resolution

2.294 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	D39
Catalytic site (residue number reindexed from 1)	D37
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	D45 D49	D43 D47
BS02	ZN	B	D39 D42	D37 D40

Gene Ontology

	Molecular Function
GO:0000035	acyl binding
GO:0000036	acyl carrier activity

	Biological Process
GO:0006633	fatty acid biosynthetic process
GO:0009245	lipid A biosynthetic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

External links

PDB	RCSB:6lvu, PDBe:6lvu, PDBj:6lvu
PDBsum	6lvu
PubMed	32283632
UniProt	Q9WZD0\|ACP_THEMA Acyl carrier protein (Gene Name=acpP)