Structure of PDB 6ltv Chain B

Receptor sequence

>6ltvB (length=381) Species: 237895 (Cryptosporidium hominis)

EQFLFSSESVCSGHPDKLCDQISDAILDACLEQDPESFVACETCTKTGFI
MVFGEITTKANVNYERVVRETVKEIGYDSEEKGLDYKTMDVIIKLEQQSN
QHVDKNVEDIGAGDQGMMFGYATNETKELMPLTHVLATSITRELDYIRMK
GVSSRVGWLRPDGKAQVTVEYNCKHGVLIPKRIHTILVSVQHDENIENEE
IREFVLENVIKKVCPSDLMDKETRILINPSGRFTIGGPAADAGLTGRKII
VDTYGGWGAHGGGAFSGKDATKVDRSGAYMARLVAKSIVFSGLCSRCLVQ
VSYGAGIARPLSLYINTFGTAKDGYNDTKLLEIVNKVFDFRPGILIKQLN
LKSPIFKKTSSGGHFGRSEKEFLWEKPIILQ

3D structure

• PDB: 6ltv Engineered SAM Synthetases for Enzymatic Generation of AdoMet Analogs with Photocaging Groups and Reversible DNA Modification in Cascade Reactions.
• Chain: B
• Resolution: 1.87 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H34 D36 K37 E62 E75 K189 F258 D266 A267 R272 K273 K293 K297 D299
• Catalytic site (residue number reindexed from 1): H14 D16 K17 E42 E55 K164 F233 D241 A242 R247 K248 K268 K272 D274
• Enzyme Commision number: 2.5.1.6: methionine adenosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3PO	B	A289 K293	A264 K268
BS02	EU9	B	E75 Q118 S119 G138 D139 K297	E55 Q98 S99 G113 D114 K272
BS03	3PO	B	H34 D36 K189 R272 K273	H14 D16 K164 R247 K248
BS04	EU9	B	H34 P35 D187 S214 S255 F258 D266	H14 P15 D162 S189 S230 F233 D241

Gene Ontology

Molecular Function

• GO:0004478 methionine adenosyltransferase activity
• GO:0005524 ATP binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006556 S-adenosylmethionine biosynthetic process
• GO:0006730 one-carbon metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6ltv, PDBe:6ltv, PDBj:6ltv
• PDBsum: 6ltv
• PubMed: 33017502
• UniProt: A0A0S4TKQ5