Structure of PDB 6lsv Chain B

Receptor sequence

>6lsvB (length=338) Species: 3702 (Arabidopsis thaliana)

DEWPEPIVRVQSLAESNLSSLPDRYIKPASLRPATNIPIIDLEGLDDVIM
ARISEACRGWGFFQVVNHGVKPELMDAARENWREFFHMPVNAKETYSNSP
RTYEGYGSRLGVEKGASLDWSDYYFLHLLPHHLKDFNKWPSFPPTIREVI
DEYGEELVKLSGRIMRVLSTNLGLKEDKFQEAFGGENIGACLRVNYYPKC
PRPELALGLSPHSDPGGMTILLPDDQVFGLQVRKDDTWITVKPHPHAFIV
NIGDQIQILSNSTYKSVEHRVIVNSDKERVSLAFFYNPKSDIPIQPLQEL
VSTHNPPLYPPMTFDQYRLFIRTQGPQGKSHVESHISP

3D structure

• PDB: 6lsv Structure-guided analysis of Arabidopsis JASMONATE-INDUCED OXYGENASE (JOX) 2 reveals key residues for recognition of jasmonic acid substrate by plant JOXs.
• Chain: B
• Resolution: 2.651 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H244 D246 H301
• Catalytic site (residue number reindexed from 1): H212 D214 H269
• Enzyme Commision number: 1.14.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AKG	B	N227 Y229 L253 L262 V303 R311 S313	N195 Y197 L221 L230 V271 R279 S281
BS02	JAA	B	Y135 F157 R225 H244 R350 R354	Y103 F125 R193 H212 R318 R322
BS03	FE	B	H244 D246 H301	H212 D214 H269

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0046872 metal ion binding
• GO:0051213 dioxygenase activity
• GO:0120091 jasmonic acid hydrolase

Biological Process

• GO:0006952 defense response
• GO:0097237 cellular response to toxic substance
• GO:1900150 regulation of defense response to fungus
• GO:1900366 negative regulation of defense response to insect
• GO:2000022 regulation of jasmonic acid mediated signaling pathway

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6lsv, PDBe:6lsv, PDBj:6lsv
• PDBsum: 6lsv
• PubMed: 33516967
• UniProt: Q9FFF6|JOX2_ARATH Jasmonate-induced oxygenase 2 (Gene Name=JOX2)