Structure of PDB 6lke Chain B

Receptor sequence

>6lkeB (length=421) Species: 10116 (Rattus norvegicus) [Search protein sequence]

TEGKRVVVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVASINLALSYR
GRQALKAVGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISR
EKLNKDLLTAVESYPNAKVHFGHKLSKCCPGILTMLGPNKVPRDITCDLI
VGCDGAYSTVRAHLMKKPRFDYSQQYIPHGYMELTIPPKNGEYAMEPNCL
HIWPRNAFMMIALPNMDKSFTCTLFMSFEEFEKLPTHSDVLDFFQKNFPD
AIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSRCVLMGDAAHAIVPFF
GQGMNAGFEDCLVFDELMDKFNNDLSVCLPEFSRFRIPDDHAISDLSMYN
YIEMRAHVNSRWFLFQRLLDKFLHALMPSTFIPLYTMVAFTRIRYHEAVL
RWHWQKKVINRGLFVLGSLVA

3D structure

PDB

6lke Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.13.9: kynurenine 3-monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	L18 V19 Y37 E38 A39 R40 S53 L56 A57 R111 K135 D167 T172 D304 P311 G314 Q315 G316 M317 N318	L13 V14 Y32 E33 A34 R35 S42 L45 A46 R100 K124 D154 T159 D291 P298 G301 Q302 G303 M304 N305
BS02	EGU	B	R85 Y99 L213 I215 M222 I224 T236 P311 F313 G314	R74 Y88 L200 I202 M209 I211 T223 P298 F300 G301

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0004502	kynurenine 3-monooxygenase activity
GO:0016174	NAD(P)H oxidase H2O2-forming activity
GO:0050660	flavin adenine dinucleotide binding
GO:0071949	FAD binding

	Biological Process
GO:0006569	tryptophan catabolic process
GO:0009435	NAD biosynthetic process
GO:0009651	response to salt stress
GO:0014049	positive regulation of glutamate secretion
GO:0019363	pyridine nucleotide biosynthetic process
GO:0019674	NAD metabolic process
GO:0019805	quinolinate biosynthetic process
GO:0032496	response to lipopolysaccharide
GO:0034276	kynurenic acid biosynthetic process
GO:0034354	'de novo' NAD biosynthetic process from tryptophan
GO:0043420	anthranilate metabolic process
GO:0070189	kynurenine metabolic process
GO:0071222	cellular response to lipopolysaccharide
GO:0071347	cellular response to interleukin-1
GO:0097052	L-kynurenine metabolic process
GO:1903296	positive regulation of glutamate secretion, neurotransmission

	Cellular Component
GO:0005615	extracellular space
GO:0005739	mitochondrion
GO:0005741	mitochondrial outer membrane
GO:0031966	mitochondrial membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lke, PDBe:6lke, PDBj:6lke
PDBsum	6lke
PubMed	33542467
UniProt	O88867\|KMO_RAT Kynurenine 3-monooxygenase (Gene Name=Kmo)

[Back to BioLiP]