Structure of PDB 6l6q Chain B

Receptor sequence
>6l6qB (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRR
RNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLP
3D structure
PDB6l6q Structural basis of binding of homodimers of the nuclear receptor NR4A2 to selective Nur-responsive DNA elements.
ChainB
Resolution2.601 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B E281 G282 F286 R289 K293 R312 N313 Q316 R319 R342 G343 R344 E20 G21 F25 R28 K32 R51 N52 Q55 R58 R81 G82 R83
BS02 dna B C272 Q273 H274 Y275 V332 V333 R334 R342 G343 C11 Q12 H13 Y14 V71 V72 R73 R81 G82
BS03 ZN B C263 C280 C283 C2 C19 C22
BS04 ZN B C299 C305 C315 C318 C38 C44 C54 C57
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6l6q, PDBe:6l6q, PDBj:6l6q
PDBsum6l6q
PubMed31723028
UniProtP43354|NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 (Gene Name=NR4A2)

[Back to BioLiP]