Structure of PDB 6kq1 Chain B

Receptor sequence

>6kq1B (length=82) Species: 306 (Pseudomonas sp.)

QDGEALFKSKPCAACHSIDAKMVGPALKEVAAKYAGQEGAADLLAGHIKN
GTQGNWGPIPMPPNPVTEEEAKTLAEWVLSLK

3D structure

• PDB: 6kq1 Structural insights into high stability of cytochrome c551 from a deep-sea piezo-tolerant bacterium, Pseudomonas sp. strain MT-1
• Chain: B
• Resolution: 1.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	D2 E4	D2 E4
BS02	ZN	B	K10 E70	K10 E70
BS03	HEC	B	C12 C15 H16 G24 P25 Y34 L44 H47 I48 Q53 G54 N55 W56 G57 M61 N64	C12 C15 H16 G24 P25 Y34 L44 H47 I48 Q53 G54 N55 W56 G57 M61 N64

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 22:56:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kq1', asym_id = 'B', title = 'Structural insights into high stability of cytoc...o-tolerant bacterium, Pseudomonas sp. strain MT-1'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kq1', asym_id='B', title='Structural insights into high stability of cytoc...o-tolerant bacterium, Pseudomonas sp. strain MT-1')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005506,0009055,0020037', uniprot = '', pdbid = '6kq1', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005506,0009055,0020037', uniprot='', pdbid='6kq1', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>