Structure of PDB 6kls Chain B

Receptor sequence

>6klsB (length=395) Species: 63363 (Aquifex aeolicus)

IVDWIDERAHVREIYRTQMVEYKVAKNLTFPYVFGILALVTFAIQIISGM
VLILYYKPSIADAFDSATYSIMGEIPFGWLFRHIHATGANFFMAIVYLHM
FTGIYYNAYKRPRELVWIVGWLIYFVLILTALSGYLLPWGQLSYWGFIVT
TEIPGSLADAPILKPIFKAIAETIVLWMKGGYVVTDVTLGRVFGSHVLIY
PLILLALVGIHLYLVRAAGISNPEGIEYDKKKNPDKFVPFHPYMTLKEGA
YVMWYLAVFFFFVFFHISHFLPPENFEPANPLKTPAHIAPEWYLLGYYEV
FRSIPSKFWGFVAFNALLLLLLLLPFLDFSPLKSARRRPLFFVMFVIFMI
SSMALTILGTMPPTPQNAKLGLIFAALVFAFFISLPIISFIEYGW

3D structure

• PDB: 6kls A 3.3 angstrom -Resolution Structure of Hyperthermophilic Respiratory Complex III Reveals the Mechanism of Its Thermal Stability.
• Chain: B
• Resolution: 3.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R222 I226 K253 E254 E297
• Catalytic site (residue number reindexed from 1): R216 I220 K247 E248 E291

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F48 Q51 G55 L58 R88 H91 A95 F98 T136 G140 L143 P144 H202 V203 P207	F42 Q45 G49 L52 R82 H85 A89 F92 T130 G134 L137 P138 H196 V197 P201
BS02	HEM	B	Y38 G41 L45 F98 H105 M106 A114 G126 H217 L218 V221 S227	Y32 G35 L39 F92 H99 M100 A108 G120 H211 L212 V215 S221
BS03	DLX	B	Q24 M56 L218	Q18 M50 L212
BS04	DLX	B	I53 P82 F83 F87 F266	I47 P76 F77 F81 F260
BS05	DLX	B	L208 I209	L202 I203

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:6kls, PDBe:6kls, PDBj:6kls
• PDBsum: 6kls
• PubMed: 31778296
• UniProt: O66459