Structure of PDB 6kbs Chain B

Receptor sequence

>6kbsB (length=227) Species: 562 (Escherichia coli)

CGRFAQSQTREDYLALLAEDIERDIPYDPEPIGRYNVAPGTKVLLLSERD
EHLHLDPVFWGYAPGWWDKPPLINARVETAATSRMFKPLWQHGRAICFAD
GWFEWKKEGDKKQPFFIYRADGQPIFMAAIGSTPFERGDEAEGFLIVTAA
ADQGLVDIHDRRPLVLSPEAAREWMRQEISGKEASEIAASGCVPANQFSW
HPVSRAVGNVKNQGAELIQPVLEVLFQ

3D structure

• PDB: 6kbs Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.
• Chain: B
• Resolution: 1.601 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	G3 R4 P40 W67 W68 K70 L73 N75 R77 S84 R85 M86 F87 W106 K113 T149 H160 R162 G209	G2 R3 P39 W66 W67 K69 L72 N74 R76 S83 R84 M85 F86 W105 K112 T148 H159 R161 G208	PDBbind-CN: Kd=2.2uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 04:58:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kbs', asym_id = 'B', title = 'Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kbs', asym_id='B', title='Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003697,0006974,0106300', uniprot = '', pdbid = '6kbs', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003697,0006974,0106300', uniprot='', pdbid='6kbs', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>