Structure of PDB 6k59 Chain B

Receptor sequence

>6k59B (length=32) Species: 32630 (synthetic construct)

FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR

3D structure

• PDB: 6k59 Molecular Details of a Salt Bridge and Its Role in Insulin Fibrillation by NMR and Raman Spectroscopic Analysis.
• Chain: B
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 H5 C7 L11 C19 R22 F24 Y26 P28 K29 R31	F1 N3 H5 C7 L11 C19 R22 F24 Y26 P28 K29 R31

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:6k59, PDBe:6k59, PDBj:6k59
• PDBsum: 6k59
• PubMed: 31958230
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)