Structure of PDB 6jzd Chain B

Receptor sequence
>6jzdB (length=35) Species: 9606 (Homo sapiens) [Search protein sequence]
SAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQ
3D structure
PDB6jzd Structural basis of tubulin detyrosination by VASH2/SVBP heterodimer.
ChainB
Resolution2.479 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B Q53 F54 F57 Q28 F29 F32
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0016504 peptidase activator activity
Biological Process
GO:0006508 proteolysis
GO:0009306 protein secretion
GO:0010596 negative regulation of endothelial cell migration
GO:0031397 negative regulation of protein ubiquitination
GO:0061564 axon development
GO:1905048 regulation of metallopeptidase activity
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jzd, PDBe:6jzd, PDBj:6jzd
PDBsum6jzd
PubMed31324789
UniProtQ8N300|SVBP_HUMAN Small vasohibin-binding protein (Gene Name=SVBP)

[Back to BioLiP]