Structure of PDB 6jwp Chain B

Receptor sequence
>6jwpB (length=294) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLA
VMELPGQYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAY
KVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSF
YLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVN
SKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAELQNVSQLANGVII
YLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDIW
3D structure
PDB6jwp Structural insights into the EGO-TC-mediated membrane tethering of the TORC1-regulatory Rag GTPases.
ChainB
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP B R19 C20 G21 K22 S23 S24 T38 L39 S43 T44 H124 K125 I166 R10 C11 G12 K13 S14 S15 T29 L30 S34 T35 H113 K114 I155
BS02 MG B S23 T44 S14 T35
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0006995 cellular response to nitrogen starvation
GO:0009267 cellular response to starvation
GO:0010507 negative regulation of autophagy
GO:0016237 microautophagy
GO:0032008 positive regulation of TOR signaling
GO:0032456 endocytic recycling
GO:0034599 cellular response to oxidative stress
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071230 cellular response to amino acid stimulus
GO:1903778 protein localization to vacuolar membrane
GO:1904263 positive regulation of TORC1 signaling
Cellular Component
GO:0000329 fungal-type vacuole membrane
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005770 late endosome
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0016020 membrane
GO:0031902 late endosome membrane
GO:0045121 membrane raft
GO:0071986 Ragulator complex
GO:1990131 Gtr1-Gtr2 GTPase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jwp, PDBe:6jwp, PDBj:6jwp
PDBsum6jwp
PubMed31579828
UniProtP53290|RAGCD_YEAST GTP-binding protein GTR2 (Gene Name=GTR2)

[Back to BioLiP]