Structure of PDB 6jnn Chain B

Receptor sequence

>6jnnB (length=89) Species: 3702 (Arabidopsis thaliana)

RNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRT
EHIRVHTGARPYVCAEPDCGQTFRFVSDFSRHKRKTGHS

3D structure

• PDB: 6jnn DNA methylation repels targeting of Arabidopsis REF6.
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K1275 F1277 F1278 Y1282 H1286 W1309 S1312 H1316 F1339 D1342	K11 F13 F14 Y18 H22 W45 S48 H52 F75 D78	PDBbind-CN: Kd=65.7nM
BS02	dna	B	W1311 Y1326 V1340 S1341 S1344 K1347 R1348	W47 Y62 V76 S77 S80 K83 R84	PDBbind-CN: Kd=65.7nM
BS03	ZN	B	C1268 C1273 H1286 H1290	C4 C9 H22 H26
BS04	ZN	B	C1298 C1303 H1316 H1320	C34 C39 H52 H56
BS05	ZN	B	C1333 H1346 H1352	C69 H82 H88

External links

• PDB: RCSB:6jnn, PDBe:6jnn, PDBj:6jnn
• PDBsum: 6jnn
• PubMed: 31048693
• UniProt: Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 (Gene Name=REF6)