Structure of PDB 6jf3 Chain B

Receptor sequence
>6jf3B (length=146) Species: 470 (Acinetobacter baumannii) [Search protein sequence]
SVVLPVAKRGEDILKLIAAPVSANELNSNWLYQLADAMHATMLERNGVGI
AAPQVYISKRVIIVASNAVVMVNPEILEFSSEMCLGEEGCLSVPERGQVE
RAEMVKVKYLTLQGEMVETVFQGFPARIVQHEVDHLNGILFVERIS
3D structure
PDB6jf3 Actinonin bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii
ChainB
Resolution2.01 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN B C103 H145 H149 C90 H131 H135
BS02 BB2 B G48 V49 G50 Q55 E100 E101 G102 C103 L104 R110 F138 H145 E146 H149 G47 V48 G49 Q54 E87 E88 G89 C90 L91 R96 F124 H131 E132 H135
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Dec 2 06:25:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6jf3', asym_id = 'B', title = 'Actinonin bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6jf3', asym_id='B', title='Actinonin bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0042586', uniprot = '', pdbid = '6jf3', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042586', uniprot='', pdbid='6jf3', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>