Structure of PDB 6jdg Chain B

Receptor sequence
>6jdgB (length=98) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
RGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESERTEWHRVVFFGR
LAEIAGEYLRKGSQVYVEGSLRTRKWQGQDRYTTEIVVDINGNMQLLG
3D structure
PDB6jdg Complexed crystal structure of SSB reveals a novel single-stranded DNA binding mode (SSB)3:1: Phe60 is not crucial for defining binding paths.
ChainB
Resolution2.388 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R3 E80 I105 N106 R1 E68 I90 N91
BS02 dna B N13 V14 G15 E19 R21 A35 W54 R56 K73 G74 W88 N11 V12 G13 E17 R19 A33 W42 R44 K61 G62 W76
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jdg, PDBe:6jdg, PDBj:6jdg
PDBsum6jdg
PubMed31604524
UniProtP40947|SSB_PSEAE Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]