Structure of PDB 6j7f Chain B

Receptor sequence

>6j7fB (length=329) Species: 9606 (Homo sapiens)

TPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYW
GLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAV
QILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVAT
LALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLA
ITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKII
GRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLG
EEQIKPVNPVFCMPEEVLQRVNVQPELVS

3D structure

• PDB: 6j7f Complex of GGTaseIII, farnesyl-Ykt6 (C-terminal methylated), and GGPP
• Chain: B
• Resolution: 2.883 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.60: protein geranylgeranyltransferase type II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAR	B	Y30 G49 I50 W52 F289	Y28 G47 I48 W50 F287
BS02	GER	B	F147 G192 C196 Y241 W244	F145 G190 C194 Y239 W242

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004659 prenyltransferase activity
• GO:0004661 protein geranylgeranyltransferase activity
• GO:0004663 Rab geranylgeranyltransferase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008318 protein prenyltransferase activity
• GO:0031267 small GTPase binding
• GO:0046872 metal ion binding

Biological Process

• GO:0007601 visual perception
• GO:0018344 protein geranylgeranylation
• GO:0036211 protein modification process

Cellular Component

• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0005968 Rab-protein geranylgeranyltransferase complex

External links

• PDB: RCSB:6j7f, PDBe:6j7f, PDBj:6j7f
• PDBsum: 6j7f
• UniProt: P53611|PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta (Gene Name=RABGGTB)