Structure of PDB 6j4e Chain B

Receptor sequence

>6j4eB (length=61) Species: 3702 (Arabidopsis thaliana)

VMEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSAGGQVVDT
VYFGEHDHPKP

3D structure

• PDB: 6j4e Crystal structure of the AtWRKY1 domain
• Chain: B
• Resolution: 3.126 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R117 K118 T137	R9 K10 T29
BS02	dna	B	Y119 K122 V124 K125 R131 Y133 R135	Y11 K14 V16 K17 R23 Y25 R27
BS03	ZN	B	C136 C141 H164 H166	C28 C33 H56 H58

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:6j4e, PDBe:6j4e, PDBj:6j4e
• PDBsum: 6j4e
• UniProt: Q9SI37|WRKY1_ARATH WRKY transcription factor 1 (Gene Name=WRKY1)