Structure of PDB 6j2p Chain B

Receptor sequence
>6j2pB (length=93) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
EDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQ
AGITGKEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREF
3D structure
PDB6j2p Structural basis for histone H3K4me3 recognition by the N-terminal domain of the PHD finger protein Spp1.
ChainB
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B D31 G33 L35 M36 V37 G38 C39 D40 W45 V61 F62 D11 G13 L15 M16 V17 G18 C19 D20 W25 V41 F42
BS02 ZN B C25 C27 H47 C50 C5 C7 H27 C30
BS03 ZN B C39 C42 C69 C19 C22 C49
BS04 ZN B C93 C98 C109 H113 C69 C74 C85 H89
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:6j2p, PDBe:6j2p, PDBj:6j2p
PDBsum6j2p
PubMed31253666
UniProtQ03012|SPP1_YEAST COMPASS component SPP1 (Gene Name=SPP1)

[Back to BioLiP]