Structure of PDB 6j28 Chain B

Receptor sequence

>6j28B (length=345) Species: 262724 (Thermus thermophilus HB27)

VNKEALVQVAEEVRRATGLPVGWRDVERTLGALRATRDLWEAVRLSRVPL
RFLVPIWEGLARRGLLRVEEGLDLLAEVPAPRPGEAACPACEGRGLVGER
LPGRAAERFLAWAKERPEAIQDFDQGYVTPESTLARVALAWNWGDLEGKE
VLVLGDDDLTGLAAALTGLPKRVVVLDADPRIVRFLERAAKAEGLPLEAH
VHDLREPLPEAWVHAFHTFFTDPVEGPLGLQAFVGRGLLALEGEGCAGYV
GLTHVEASLAKWADFQRFLLENGAVITELRDGFHVYENWGYIEQMRAWPW
LPVKRRPEKPWYTSALIRLELLRRADLENARVEGDLYDDEESSTT

3D structure

• PDB: 6j28 The C-terminal flexible region of branched-chain polyamine synthase facilitates substrate specificity and catalysis.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.128: N(4)-bis(aminopropyl)spermidine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	N4P	B	D133 G135 D166 D167 D231 P232 E234 E265 W298 Y300 Y321 T353	D124 G126 D157 D158 D222 P223 E225 E256 W289 Y291 Y312 T344
BS02	MTA	B	F132 D133 Q134 G164 D166 D186 A187 D212 L213 D231 F242 Y346	F123 D124 Q125 G155 D157 D177 A178 D203 L204 D222 F233 Y337
BS03	FE	B	C97 C100	C88 C91

Gene Ontology

Molecular Function

• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding

Biological Process

• GO:0006596 polyamine biosynthetic process
• GO:0009058 biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6j28, PDBe:6j28, PDBj:6j28
• PDBsum: 6j28
• PubMed: 31162806
• UniProt: Q72L89