Structure of PDB 6j26 Chain B

Receptor sequence

>6j26B (length=353) Species: 69014 (Thermococcus kodakarensis KOD1)

SHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLV
VAVVTALYELGYVAFENNQVILTRKGKELVEKYGIGPRADYTCSHCQGRT
VEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDL
ENKEVFVLGDDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYE
NIEIFTFDLRKPLPDYALHKFDTFITDPPETVEAIRAFVGRGIATLKGPG
CAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEE
TRAWRLLPIKVKPSYNWYKSYMFRIQTLEGSKGFEDEITVGQELYDDEES
STT

3D structure

• PDB: 6j26 The C-terminal flexible region of branched-chain polyamine synthase facilitates substrate specificity and catalysis.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.128: N(4)-bis(aminopropyl)spermidine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	B	C91 C94	C93 C96
BS02	MTA	B	F125 Q127 D159 D179 I180 F205 D206 L207 P227 F236 Y343	F127 Q129 D161 D181 I182 F207 D208 L209 P229 F238 Y345
BS03	B5L	B	D126 A128 D159 D160 D225 P226 E228 G254 T256 E259 Y290 Y295 Y316 T350	D128 A130 D161 D162 D227 P228 E230 G256 T258 E261 Y292 Y297 Y318 T352

Gene Ontology

Molecular Function

• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups

Biological Process

• GO:0006596 polyamine biosynthetic process
• GO:0009058 biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6j26, PDBe:6j26, PDBj:6j26
• PDBsum: 6j26
• PubMed: 31162806
• UniProt: Q5JIZ3|BPSA_THEKO N(4)-bis(aminopropyl)spermidine synthase (Gene Name=bpsA)