Structure of PDB 6is8 Chain B

Receptor sequence

>6is8B (length=163) Species: 4577 (Zea mays) [Search protein sequence]

GWVIGVNPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP

3D structure

PDB

6is8 Structural basis of sequence-specific Holliday junction cleavage by MOC1.

Chain

Resolution

1.68 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	D117 I118 R148 R150 K175 F179 P180 D182 Q185 G186 W187 S189 T190 A212 Q214 T215 K217 M223 R224	D9 I10 R40 R42 K67 F71 P72 D74 Q77 G78 W79 S81 T82 A104 Q106 T107 K109 M115 R116
BS02	dna	B	V143 S144 R148 T181 D182 G183 K184 Q185 G186 L249 K250 K251	V35 S36 R40 T73 D74 G75 K76 Q77 G78 L141 K142 K143
BS03	MG	B	N115 D117	N7 D9

Gene Ontology

	Molecular Function
GO:0008821	crossover junction DNA endonuclease activity

View graph for
Molecular Function

External links

PDB	RCSB:6is8, PDBe:6is8, PDBj:6is8
PDBsum	6is8
PubMed	31611704
UniProt	B4FCI7

[Back to BioLiP]